SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027783 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027783
Domain Number 1 Region: 65-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000026
Family EGF-type module 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027783   Gene: ENSPTRG00000016166   Transcript: ENSPTRT00000030098
Sequence length 169
Comment pep:known chromosome:CHIMP2.1.4:4:55688607:55708381:-1 gene:ENSPTRG00000016166 transcript:ENSPTRT00000030098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAGRRMEMLCAGRVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRV
AQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVA
LTVILIILFLITVVGSTYYFCRWYRNQKSKEPKKEYERVTSGDPELPQV
Download sequence
Identical sequences H2QPP3
ENSPTRP00000027783 ENSPTRP00000027783 XP_001155238.1.37143 9598.ENSPTRP00000027783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]