SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027784 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027784
Domain Number 1 Region: 141-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000001
Family EGF-type module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027784   Gene: ENSPTRG00000016167   Transcript: ENSPTRT00000030099
Sequence length 252
Comment pep:known chromosome:CHIMP2.1.4:4:55618506:55628318:-1 gene:ENSPTRG00000016167 transcript:ENSPTRT00000030099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSG
SEISPVSEMPSSSELSSGADYDYSEEYDNELQIPGYIVDDSVRVEQVVKPPKNKTESENT
SDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
CGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAIAVITVQLRRRYVRKYEGEAEERKK
LRQENGNVHAIA
Download sequence
Identical sequences H2QPP4
9598.ENSPTRP00000027784 XP_003832370.1.60992 XP_517224.2.37143 ENSPTRP00000027784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]