SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027785 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027785
Domain Number 1 Region: 64-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000544
Family EGF-type module 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027785   Gene: ENSPTRG00000016168   Transcript: ENSPTRT00000030100
Sequence length 178
Comment pep:known_by_projection chromosome:CHIMP2.1.4:4:55291165:55341046:1 gene:ENSPTRG00000016168 transcript:ENSPTRT00000030100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRAARGSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQS
KRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQIL
VICLIAVMVVFIILVIGVCTCCHPLRKRHKRKKKEEEMETLDKDITPVNEDIEETNIA
Download sequence
Identical sequences H2QPP5
ENSPTRP00000027785 ENSPTRP00000027785 9598.ENSPTRP00000027785 XP_008955970.1.60992 XP_009446008.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]