SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027890 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027890
Domain Number 1 Region: 25-123
Classification Level Classification E-value
Superfamily PDB 9.4e-48
Family PDB 0.00000121
Further Details:      
 
Domain Number 2 Region: 50-127
Classification Level Classification E-value
Superfamily Ribosomal protein S18 1.54e-26
Family Ribosomal protein S18 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027890   Gene: ENSPTRG00000016233   Transcript: ENSPTRT00000030213
Sequence length 142
Comment pep:known_by_projection chromosome:CHIMP2.1.4:4:46534569:46540378:-1 gene:ENSPTRG00000016233 transcript:ENSPTRT00000030213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLPISMENPYKE
PLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFM
PVTYKDPAYLKDPKVCNIRYRE
Download sequence
Identical sequences A0A024RDH9 H2QPT6 Q9Y3D5
NP_057151.1.87134 NP_057151.1.92137 XP_003832291.1.60992 XP_517249.1.37143 ENSP00000295491 9598.ENSPTRP00000027890 9606.ENSP00000295491 ENSP00000295491 ENSPTRP00000027890 gi|7705630|ref|NP_057151.1| ENSPTRP00000027890 ENSP00000295491 3j9m_AP

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]