SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028038 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028038
Domain Number 1 Region: 323-690
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.24e-105
Family beta-glycanases 0.00000063
Further Details:      
 
Domain Number 2 Region: 21-211
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.84e-51
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00033
Further Details:      
 
Domain Number 3 Region: 214-324
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000000000000379
Family beta-Galactosidase/glucuronidase domain 0.0056
Further Details:      
 
Domain Number 4 Region: 696-795
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000000273
Family beta-Galactosidase/glucuronidase domain 0.016
Further Details:      
 
Domain Number 5 Region: 801-879
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000187
Family beta-Galactosidase/glucuronidase domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028038   Gene: ENSPTRG00000016322   Transcript: ENSPTRT00000030372
Sequence length 879
Comment pep:known chromosome:CHIMP2.1.4:4:105171707:105304951:-1 gene:ENSPTRG00000016322 transcript:ENSPTRT00000030372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLHLLLLLALCGAGTTAAELSYSLRGNWSICNGNGSLELPGAVPGCVHSALFQQGLIQD
SYYRFNDLNYRWVSLDNWTYSKEFKIPFEISKWQKVNLILEGVDTVSKILFNEVTIGETD
NMFNRYSFDITNVVRDVNSIELRFQSAVLYAAQQSKAHTRYQVPPDCPPLVQKGECHVNF
VRKEQCSFSWDWGPSFPTQGIWKDVRIEAYNICHLNYFTFSPIYDKSAQEWNLEIESTFD
VVSSKPVGGQVIVAIPKLQTQQTYSIELQPGKRIVELFVNISKNITVETWWPHGHGNQTG
YNMTVLFELDGGLNIEKSAKVYFRTVELIEEPIKGSPGLSFYFKINGFPIFLKGSNWIPA
DSFQDRVTSELLRLLLQSVVDANMNTLRVWGGGIYEQDEFYELCDELGIMVWQDFMFACA
LYPTDQGFLDSVTAEVAYQIKRLKSHPSIIIWSGNNENEEALMMNWYHISFTDRPIYIKD
YVTLYVKNIRELVLAGDKSRPFITSSPTNGAETVAEGWVSQNPNSNYFGDVHFYDYISDC
WNWKVFPKARFASEYGYQSWPSFSTLEKVSSTEDWSFNSKFSLHRQHHEGGNKQMLYQAG
LHFKLPQSTDPLRTFKDTIYLTQVMQAQCVKTETEFYRRSSSEIVDQQGHTMGALYWQLN
DIWQAPSWASLEYGGKWKMLHYFAQNFFAPLLPVGFENENTFYIYGVSDLHSDYSMTLTV
RVHTWSSLEPMCSHVTEHFVMKGGEAVCLYEEPVSELLRRCGNCTRESCVVSFYLSADHE
LLSPTNYHFLSSPKEAVGLCKAQITAIISQQGDIFVFDLETSAVAPFVWLDVGSIPGRFS
DNGFLMTEKTRTILFYPWEPTSKNELEQSFHVTSLTDIY
Download sequence
Identical sequences H2QPY9
XP_001169005.1.37143 ENSPTRP00000028038 9598.ENSPTRP00000028038 ENSPTRP00000028038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]