SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028112 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028112
Domain Number 1 Region: 483-737
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-49
Family YWTD domain 0.00000421
Further Details:      
 
Domain Number 2 Region: 46-302
Classification Level Classification E-value
Superfamily YWTD domain 8.24e-36
Family YWTD domain 0.0000686
Further Details:      
 
Domain Number 3 Region: 401-476,733-784
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000424
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 27-42,324-408
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000033
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 5 Region: 974-1018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000149
Family EGF-type module 0.0002
Further Details:      
 
Domain Number 6 Region: 870-923
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 7 Region: 831-881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000986
Family EGF-type module 0.039
Further Details:      
 
Domain Number 8 Region: 915-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028112   Gene: ENSPTRG00000016367   Transcript: ENSPTRT00000030446
Sequence length 1207
Comment pep:known_by_projection chromosome:CHIMP2.1.4:4:112535723:112634939:1 gene:ENSPTRG00000016367 transcript:ENSPTRT00000030446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLTLIVLLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRID
TEGTNYEQLVVDAGVSVIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSG
MAINWINEEVIWSNQQEGIITVTDMKGNNSHVLLSALKYPANIAVDPVERFIFWSSEVAG
SLYRADLDGVGVKALLETSEKITAVSLDVLDKRLFWIQYNREGSNSLICSCDYDGGSVHI
SKHPTQHNLFAMSLFGDRIFYSIWKMKTIWIANKHTGKDMVRINLHSPFVPPGELKVVHP
LAQPKAEDDTWEPEQKLRKLRKGNCSSTVCGQDLQSHLCTCAEGYALSRDRKYCEDVNEC
AFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPSNVSECSHDCVLTSEGPL
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCIPLSPVSWECDCFPGYDLQLDKKSCAASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIITKENISQP
RGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVIRVNKRTGKDRVR
LQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKKRLGTAWCSCREGFMKASDGKTC
LALDGHQLLAGGEVDLKNQVTPLDILSQTRVSEDNITESQHMLVAEIMVSDQDDCAPVGC
STYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCS
EGYQGDGIHCLDIDECQLGVHSCGENASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHL
REDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW
ELRHAGHGQQQKVIVVAVCVVVLVVLLLLSLWGAHYYRTQKLLSKNPKNPYEESSRDVRS
RRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQAADGSMQPTSWRQEPRLCGM
GTEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQTLEGGVEKPHSLLSANPLWQQRALDPP
HQMELTQ
Download sequence
Identical sequences A0A2J8M2A8
9598.ENSPTRP00000028112 ENSPTRP00000028112 ENSPTRP00000028112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]