SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028379 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028379
Domain Number 1 Region: 637-782
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.31e-45
Family Toll/Interleukin receptor TIR domain 0.0000000465
Further Details:      
 
Domain Number 2 Region: 45-166,354-554
Classification Level Classification E-value
Superfamily RNI-like 1.18e-35
Family Cyclin A/CDK2-associated p19, Skp2 0.029
Further Details:      
 
Domain Number 3 Region: 143-235
Classification Level Classification E-value
Superfamily L domain-like 0.00000816
Family Internalin LRR domain 0.065
Further Details:      
 
Domain Number 4 Region: 226-402
Classification Level Classification E-value
Superfamily L domain-like 0.0000453
Family U2A'-like 0.068
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000028379
Domain Number - Region: 592-653
Classification Level Classification E-value
Superfamily Fumarate reductase respiratory complex transmembrane subunits 0.000161
Family Fumarate reductase respiratory complex cytochrome b subunit, FrdC 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028379   Gene: ENSPTRG00000016528   Transcript: ENSPTRT00000030727
Sequence length 784
Comment pep:known chromosome:CHIMP2.1.4:4:156752712:156755066:1 gene:ENSPTRG00000016528 transcript:ENSPTRT00000030727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLS
NNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWF
KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELE
IDASDLQSYESKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFRFS
ELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN
DRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLK
SLEYLDLSENLIVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNVDI
SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLK
ELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCE
FLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFL
LILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMV
QELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFS
HFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRA
AIKS
Download sequence
Identical sequences H2QQA8 S5PGN6
ENSPTRP00000028379 ENSPTRP00000028379 XP_009446590.1.37143 XP_009446592.1.37143 XP_009446594.1.37143 XP_016806508.1.37143 9598.ENSPTRP00000028379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]