SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028473 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028473
Domain Number 1 Region: 47-142
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-18
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028473   Gene: ENSPTRG00000016591   Transcript: ENSPTRT00000030832
Sequence length 409
Comment pep:known chromosome:CHIMP2.1.4:4:173191551:173231265:-1 gene:ENSPTRG00000016591 transcript:ENSPTRT00000030832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRLKSHLTVCFLPSVPFLILVSTLATAKSVTNSTLNGTNVVLGSVPVIIARTDHIIVKE
GNSALINCSVYGIPDPQFKWYNSIGKLLKEEEDEKERGGGKWQMHDSGLLNITKVSFSDR
GKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYYMVVCLVAFTIVMVLNITRLCMMSSHLK
KTEKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARS
VPLPPLIMNCRTIMEEIMEVVGLEEQGQNFVRHTPEGQEATDRDEVYTIPNSLKRSDSPA
ADSDASSLHEQPQQIAIKVSVHPQSKKEHADDQEGGQFEVKDVEETELSAEHSPETAEPS
TDVTSTELTSEEPTPVEVPDKVLPPAYLEATEPAVTHDKNTCIIYESHV
Download sequence
Identical sequences H2QQF2
ENSPTRP00000028473 ENSPTRP00000028473 XP_008973514.1.60992 XP_008973515.1.60992 XP_016807993.1.37143 XP_016807994.1.37143 XP_016807995.1.37143 XP_016807996.1.37143 XP_016807997.1.37143 XP_016807998.1.37143 9598.ENSPTRP00000028473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]