SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028590 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028590
Domain Number 1 Region: 217-399
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-54
Family SPRY domain 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028590   Gene: ENSPTRG00000016668   Transcript: ENSPTRT00000030951
Sequence length 411
Comment pep:known_by_projection chromosome:CHIMP2.1.4:4:191444910:191459858:-1 gene:ENSPTRG00000016668 transcript:ENSPTRT00000030951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCGIQEAAENYRKLFQEILNTSREKLEAAKSILTEEQERMAMIQEEEQNFKKMIESEYS
MRLRLLNEECEQNLQRQQECVSDLNLRETLLNQVIKLATELEEMFQEMLQRLGRVGRENM
EKLKESEARASEQVRSLLKLIVELEKKCGEGTLALLKCLDLEIRPPELREMNFCCAEAAQ
SMNAKYSLERSKSLLLEHLEPAHITDLSLCHIRGLSSMFRVLQRHLTLDPETAHPCLALS
EDLRTMRLRHGQQDGAGNPERLDFSAMVLAAESFTSGRHYWEVDVGKATRWQVGIYHGSA
DAKGSTARVSGEKVLLTGSVMGTEWTLWVFPPLKRLFLEKKLDTVGVFLDCEHGQISFYN
VTETSLIYNFSHCAFQGALRPVFSLCIPNGDTSPDSLTILHGPSCDATVSP
Download sequence
Identical sequences ENSPTRP00000028590 ENSPTRP00000028590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]