SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028592 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028592
Domain Number 1 Region: 277-464
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-65
Family SPRY domain 0.00000762
Further Details:      
 
Domain Number 2 Region: 5-87
Classification Level Classification E-value
Superfamily RING/U-box 1.37e-20
Family RING finger domain, C3HC4 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028592   Gene: ENSPTRG00000016670   Transcript: ENSPTRT00000030953
Sequence length 468
Comment pep:known_by_projection scaffold:CHIMP2.1.4:GL389904.1:1393:9199:1 gene:ENSPTRG00000016670 transcript:ENSPTRT00000030953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTADLMENLREELTCFICLDYFSSPVTTECGHSFCLVCLLRSWEEHNTPLSCPECWRTL
EGPHFQSNERLGRLASIARQLRSQVLQSEDEQGSYGRMPTTAKALSDDEQGGSTFVAQSH
GANRVYLSSEAEEHHREKLQEILNLLRVRRKEAQAVLTHEKERVKLCQEETKTCKQVVVS
EYMKMHQFLKEEEQLQLQLLEQEERENMRKLRNNEIKLTQQIRSLSKMIGQIESSSQSSA
FESLEEVRGALERSEPLLLQCPEATTTELSLCRITGMKEMLRKFSTEITLDPATANAYLV
LSEDLKSVKYGGSRQQLPDNPERFDQSATVLGAQIFTSGRHYWEVEVGNKTEWEVGICKD
SVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGVFLDYECGHIAF
YNGTDESLIYSFPPASFQEALRPIFSPCLPNEGTNTDPLTICSLNSHV
Download sequence
Identical sequences 9598.ENSPTRP00000028592 ENSPTRP00000028592 ENSPTRP00000028592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]