SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028616 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028616
Domain Number 1 Region: 26-142
Classification Level Classification E-value
Superfamily L domain-like 4.42e-21
Family U2A'-like 0.03
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000028616
Domain Number - Region: 496-580
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0011
Family PspA lactotransferrin-binding region 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028616   Gene: ENSPTRG00000016685   Transcript: ENSPTRT00000030980
Sequence length 626
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:734951:774222:1 gene:ENSPTRG00000016685 transcript:ENSPTRT00000030980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAGPRLVLSEEAVRAKSGLGPHRDLAELRSLSIPGTYQEKITHLGHSLMSLTGLKSLD
LSRNSLVSLEGIQYLTALESLNLYYNCISSLAEVFRLHALTELVDVDFRLNPVVKVEPDY
RLFVVHLLPKLQQLDDRPVRESERKASRLHFASEDSLDSKESVPASLKEGRPHHPRAKCT
EALAKQSLVMDADDEAVLNLIAECEWDLGRPPGSTSFSQKGREADSRGSQESRHLLSPQL
VQYQCGDSGKQGRETRRSSCRGCCLEKTPWSQLCGELPPPYGAEPEASRAPGPHAYFTPH
PDSVDTEDSASSQKLDLSAEMVPGPLPAPGKCRKRRMPVGRFQTFSDQEGLGCLERTHGS
SVPEESLSRQDSSESRNGRTLSQPEASETEEQRSRGVTDTREPSPGSHSALPGKKTALQA
ALLETLLDLVDRSWGGCRSLHSNEAFLAQARHILSSVEEFTAAQDSSAMVGEDVGSLALE
SKSLQSRLAEQQQQHTREMSEVTAELHCTHKELDDLRQHLDKSLEENSRLKSLLLSMKKE
VKSADTAATLNLQIAGLQTSVKRLCGEIVELKQHLEHYDKIQELTQMLQESHSSLVSTNE
HLLQELSQVRAQHRAEVEQMHWSYQE
Download sequence
Identical sequences ENSPTRP00000028616 ENSPTRP00000028616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]