SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028698 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028698
Domain Number 1 Region: 10-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000732
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028698   Gene: ENSPTRG00000016728   Transcript: ENSPTRT00000031069
Sequence length 230
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:10549606:10573577:1 gene:ENSPTRG00000016728 transcript:ENSPTRT00000031069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLQWSASYFSALSRGDPLPVKDR
MEMPTATQKTDTGLTQGLLKVLHKQCHHKRYVELTDLEQKWKNLCLPKEKFKALLQLDPC
ENKIKWINFLALGCSMLGGSLNTALKHLCEILTDDPEGGPARIPFKTFSYVYRYLARLDS
DVSPLETESYLASLKENIDAKKNGMIGLSDFFFPKRKLLENIENSEDVGH
Download sequence
Identical sequences H2QQN0
9598.ENSPTRP00000028698 ENSPTRP00000028698 XP_008973693.1.60992 XP_009447072.1.37143 ENSPTRP00000028698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]