SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028715 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028715
Domain Number 1 Region: 2696-2969
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-70
Family Protein kinases, catalytic subunit 0.0000024
Further Details:      
 
Domain Number 2 Region: 1904-2100
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-54
Family DBL homology domain (DH-domain) 0.0000131
Further Details:      
 
Domain Number 3 Region: 1239-1417
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-51
Family DBL homology domain (DH-domain) 0.00000000741
Further Details:      
 
Domain Number 4 Region: 2102-2224
Classification Level Classification E-value
Superfamily PH domain-like 9.44e-33
Family Pleckstrin-homology domain (PH domain) 0.00063
Further Details:      
 
Domain Number 5 Region: 1421-1539
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-32
Family Pleckstrin-homology domain (PH domain) 0.000000529
Further Details:      
 
Domain Number 6 Region: 2589-2685
Classification Level Classification E-value
Superfamily Immunoglobulin 7.39e-23
Family I set domains 0.0086
Further Details:      
 
Domain Number 7 Region: 256-392
Classification Level Classification E-value
Superfamily Spectrin repeat 6.36e-21
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 8 Region: 1053-1190
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-20
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 803-956
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-19
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 477-618
Classification Level Classification E-value
Superfamily Spectrin repeat 2.44e-18
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 11 Region: 2454-2518
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000941
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 12 Region: 1590-1681
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000018
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 13 Region: 12-166
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000000157
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 14 Region: 623-730
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000103
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 15 Region: 170-286
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000484
Family Spectrin repeat 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000028715
Domain Number - Region: 397-509
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0719
Family Spectrin repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028715   Gene: ENSPTRG00000016735   Transcript: ENSPTRT00000031086
Sequence length 3003
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:14431883:14669661:1 gene:ENSPTRG00000016735 transcript:ENSPTRT00000031086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRKNDEMKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYLAC
IPSEEVCKRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFG
SSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYISNATHMLSR
LEELQDILAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEGQKLLQRIQSSESFP
KKNSGSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMF
DWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGH
YASQQIRQIASQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDL
PSELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKA
VHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKH
TGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLE
DRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWLEELQKELLDDVYAESVEAVQDLIKRF
GQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEE
LFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMNDFDTEDLTIAEQRLQHHAD
KALTMNNLTFDVIHQGQDLLQYVNEVQASGVELLCDRDVDMATRVQDLLEFLHEKQQELD
LAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQF
QHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNAS
VAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKA
CTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRR
LDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTK
ERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISSDSN
KSSKSLQLDIIPASIPGSEVKLRDAAHELNEEKRKSARRKEFIMAELIQTEKAYVRDLRE
CMDTYLWEMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCF
VTWADKFQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSISSYLIKPVQRITKYQ
LLLKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDENIESQGELILQESFQ
VWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPC
KFALWVGRTPTSDNKIVLKASSIENKQDWIKHIREVIQERTIHLKGALKEPIHIPKTAPA
TRQKGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSN
ELTIRRGQTVEVLERPHDKPDWCLVRTTDRSPAAEGLVPCGSLCIAHSRSSMEMEGIFNH
KDSLSVSSNDASPPASVASLQPHMIGAQSSPGPKRPGNTLRKWLTSPVRRLSSGKADGHV
KKLAHKHKKSREVRKSADAGSQKDSDDSAATPQDETVEERGRNEGLSSGTLSKSSSSGMQ
SCGEEEGEEGADAVPLPPPMAIQQHSLLQPDSQDDKASSRLLVRPTSSETPSAAELVSAI
EELVKSKMALEDRPSSLLVDQGDSSSPSFNPSDNSLLSSSSPIDEMEERKSSSLKRRHYV
LQELVETERDYVRDLGYVVEGYMALMKEDGVPDDMKGKDKIVFGNIHQIYDWHRDFFLGE
LEKCLEDPEKLGSLFVKHERRLHMYIVYCQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQL
TDLLIKPVQRIMKYQLLLKDFLKYSKKASLDTSELERAVEVMCIVPRRCNDMMNVGRLQG
FDGKIVAQGKLLLQDTFLVTDQDAGLLPRCRERRIFLFEQIVIFSEPLDKKKGFSMPGFL
FKNSIKVSCLCLEENVENDPCKFALTSRTGDVVETFILHSSSPSVRQTWIHEINQILENQ
RNFLNALTSPIEYQRNHSGGGGGSGGSGGGGGSGGGGAPSGGSGHSGGPSSCGGAPSTSR
SRPSRIPQPVRHHPPVLVSSAASSQAEADKMSGTSTPGPSLPPPGAAPEAGPSAPSRRPP
GADAEGSEREAEPIPKMKVLESPRKCAANASGSSPDAPAKDARASLGTLPLGKPRTGAAS
PLNSPLSSAGDSDSLQRQTPRHAAPGKDTDRMSTCSSASEQSVQSTQSNGSESSSSSNIS
TMLVTHDYTAVKEDEINVYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHT
SAVIVENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLSNKVSVKL
LNPNYIYDVPPEFVIPLSEVTCETGETVVLRCRVCGRPKASITWKGPEHNTLNNDGHYSI
SYSDLGEATLKIVGVTTEDDGIYTCIAVNDMGSASSSASLRVLGPGMDGIMVTWKDNFDS
FYSEVAELGRGRFSVVKKCDQKGTKRAVATKFVNKKLMKRDQVTHELGILQSLQHPLLVG
LLDTFETPTSYILVLEMADQGRLLDCVVRWGSLTEGKIRAHLGEVLEAVRYLHNCRIAHL
DLKPENILVDESLAKPTIKLADFGDAVQLNTTYYIHQLLGNPEFAAPEIILGNPVSLTSD
TWSVGVLTYVLLSGVSPFLDDSVEETCLNICRLDFSFPDDYFKGVSQKAKEFVCFLLQED
PAKRPSAALALQEQWLQAGNGRSTGVLDTSRLTSFIERRKHQNDVRPIRSIKNFLQSRLL
PRV
Download sequence
Identical sequences ENSPTRP00000028715 ENSPTRP00000028715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]