SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028765 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028765
Domain Number 1 Region: 322-604
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.19e-94
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000102
Further Details:      
 
Domain Number 2 Region: 145-321
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.71e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000902
Further Details:      
 
Domain Number 3 Region: 606-712
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.33e-27
Family Anticodon-binding domain of Class II aaRS 0.0012
Further Details:      
 
Domain Number 4 Region: 83-143
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000183
Family TGS domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028765   Gene: ENSPTRG00000016775   Transcript: ENSPTRT00000031143
Sequence length 723
Comment pep:known chromosome:CHIMP2.1.4:5:81723480:81751143:-1 gene:ENSPTRG00000016775 transcript:ENSPTRT00000031143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEEKASSPSGKMGGEEKPIGAGEEKQKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEM
YNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIA
KVNNLVWDLDRPLEEDCSLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIE
NGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLAMFKYNKFKCRIL
NEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGI
SFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIEFI
RSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMF
DHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCL
DFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFY
GPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERM
IAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNK
KIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQAE
EEF
Download sequence
Identical sequences A0A2I3SJZ5
ENSPTRP00000028765 XP_001153971.1.37143 9598.ENSPTRP00000028765 ENSPTRP00000028765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]