SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028781 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028781
Domain Number 1 Region: 8-193
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.0000000000000137
Family Brix domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028781   Gene: ENSPTRG00000016784   Transcript: ENSPTRT00000031159
Sequence length 300
Comment pep:known chromosome:CHIMP2.1.4:5:80259003:80266529:-1 gene:ENSPTRG00000016784 transcript:ENSPTRT00000031159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKWKNKERILIFSSRGINFRTRHLMQDLRMLMPHSKADTKMDRKDKLFVINEVCEMKNCN
KCIYFEAKKKQDLYMWLSNSPHGPSAKFLVQNIHTLAELKMTGNCLKGSRPLLSFDPAFD
ELPHYALLKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAALVEIG
PRFVLNLIKIFQGSFGGPTLYENPHYQSPNMHRRVIRSITAAKYREKQQVKDVQKLRKKE
PKTLLPHDPTADVFVTPAEEKPIEIQWVKPEPKVDLKARKKRIYKRQRKMKQRMDSGKTK
Download sequence
Identical sequences ENSPTRP00000028781 ENSPTRP00000028781 9598.ENSPTRP00000028781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]