SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028819 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028819
Domain Number 1 Region: 656-848
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.04e-44
Family Laminin G-like module 0.00038
Further Details:      
 
Domain Number 2 Region: 227-431
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.17e-39
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 450-657
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-38
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 4-101
Classification Level Classification E-value
Superfamily Fibronectin type III 5.56e-20
Family Fibronectin type III 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028819   Gene: ENSPTRG00000016808   Transcript: ENSPTRT00000031202
Sequence length 873
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:76675990:76794735:-1 gene:ENSPTRG00000016808 transcript:ENSPTRT00000031202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSCLPPAAPQQPHVIVVSDSEVALSWKSGASEGSAPIQYYSVEFIRPDFDKKWTSIHERI
QMDSMVIKGLDPDTNYQFAVRAMNSHGPSPRSWPSDIIRTLCPEEAGSGRYGPRYITDMG
AGEDDEGFEDDLDLDISFEEVKPLPATKRGNKKFLVESKKMSISNPKTISRLIPPTSASL
PVTTVAPQPIPVQRKGKNGVAIMSRLFDMPCDETLCSADSFCVNDYTWGGSRCQCTLGKG
GESCSEDIVIQYPQFFGHSYVTFEPLKNSYQAFQITLEFRAEAEDGLLLYCGENEHGRGD
FMSLAIIRRSLQFRFNCGTGVAIIVSETKIKLGGWHTVMLYRDGLNGLLQLNNGTPVTGQ
SQGQYSKITFRTPLYLGGAPSAYWLVRATGTNRGFQGCVQSLAVNGRRIDMRPWPLGKAL
SGADVGECSSGICDEASCINGGTCTAIKADSYICLCPLGFKGRHCEDAFTLTIPQFRESL
RSYAATPWPLEPQHYLSFMEFEITFRPDSGDGVLLYSYDTGSKDFLSINLAGGHVEFRFD
CGSGTGVLRSEDPLTLGNWHELHVSRTAKNGILQVDKQKIVEGMAEGGFTQIKCNTDIFI
GGVPNYDDVKKNSGVLKPFSGSIQKIILNDRTIHVKHDFTSGVNVENAAHPCVRAPCAHG
GSCRPRKEGYDCDCPLGFEGLHCQKAIIEAIEIPQFIGRSYLTYDNPDILKRVSGSRSNV
FMRFKTTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGSFNDGR
WHRVKAVRDGQSGKITVDDYGARTGKSPGMMRQLNINGALYVGGMKEIALHTNRQYMRGL
VGCISHFTLSTDYHISLVEDAVDGKNINTCGAK
Download sequence
Identical sequences ENSPTRP00000028819 ENSPTRP00000028819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]