SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028839 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028839
Domain Number 1 Region: 59-166
Classification Level Classification E-value
Superfamily TPR-like 8.07e-21
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028839   Gene: ENSPTRG00000016820   Transcript: ENSPTRT00000031223
Sequence length 262
Comment pep:known chromosome:CHIMP2.1.4:5:74348907:74390317:1 gene:ENSPTRG00000016820 transcript:ENSPTRT00000031223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFGWKRKIGEKVSKVTSQQFEAEAADEKDVVDNDEGNWLHAIKRRKEILLEGCAEKSK
QLKDEGASLAENKRYREAIQKWDEALQLTPNDATLYEMKSQVLMSLHEMFPAVHAAEMAV
QRNPHSWESWQTLGRAQLGLGEIILAIRSFQVALHIYPMNPEIWKEDLSWARTLQEQQKV
AQRIKKSEAPAEVTHFSPKSIPDYDFESDEIVAVCAAIAEKEKTVSANKTMVIVSASGAI
ETVTEKEDGATPPDGSVFIKAR
Download sequence
Identical sequences H2QQT2
ENSPTRP00000028839 9598.ENSPTRP00000028839 XP_009447513.1.37143 XP_517790.1.37143 ENSPTRP00000028839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]