SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028852 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028852
Domain Number 1 Region: 52-148
Classification Level Classification E-value
Superfamily F-box domain 1.44e-18
Family F-box domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028852   Gene: ENSPTRG00000016833   Transcript: ENSPTRT00000031241
Sequence length 367
Comment pep:known chromosome:CHIMP2.1.4:5:73156072:73172657:-1 gene:ENSPTRG00000016833 transcript:ENSPTRT00000031241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSEPRRGTNSPPPPFSDWGRLEAAILSGWKTFWQSVSKERVARTTSREEVDEAASTLT
RLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPD
LEILKKPISEVTDGAFFDYMAVYRMCCPYTRRASKSSRPMYGAVTSFLHSLIIQNEPRFA
MFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQLNNQHKFNILILYSTT
RKERDRAREEHTSAVNKMFSRHKEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKR
HEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISLNHPWLVQDTEAETLTGFLNGIEWILEE
VESKRAR
Download sequence
Identical sequences 9598.ENSPTRP00000028852 ENSPTRP00000028852 ENSPTRP00000028852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]