SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029007 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029007
Domain Number 1 Region: 275-620
Classification Level Classification E-value
Superfamily L domain-like 1.11e-43
Family Ngr ectodomain-like 0.06
Further Details:      
 
Domain Number 2 Region: 31-215,268-382
Classification Level Classification E-value
Superfamily L domain-like 2.38e-38
Family Ngr ectodomain-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029007   Gene: ENSPTRG00000016939   Transcript: ENSPTRT00000031407
Sequence length 661
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:48079545:48094011:1 gene:ENSPTRG00000016939 transcript:ENSPTRT00000031407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFDVSCFFWVVLFSAGCKVITSWDQMCIEKEANKTYNCENLGLSEIPDTLPNTTEFLEF
SFNFLPTIHNRTFSRLMNLTFLDLTRCQINWIHEDTFQSHHQLSTLVLTGNPLIFMAETS
LNGPKSLKHLFLIQTGISNLEFIPVHNLENLESLYLGSNHISSIKFPKDFPARNLKVLDF
QNNAIHYISREDMRSLEQAINLSLNFNGNNVKGIELGAFDSTVFQSLNFGGTPNLSVIFN
GLQNSTTQSLWLGTFEDIDDEDISSAMLKGLCEMSVESLNLQEHRFSDISSTTFQCFTQL
QELDLTATHLKGLPSGIKGLNLLKKLVLSVNHFDQLCQISAANFPSLTHLYVRGNVKKLH
LGVGCLEKLGNLETLDLSHNDIEASDCCSLQLKNLSHLQTLNLSHNEPLGLQSQAFKECP
QLELLDLAFTRLHINAPQSPFQNLHFLQVLNLTYCFLDTSNQHLLAGLPVLRHLNLKGNH
FQDGTITKTNLLQTVGSLEVLILSSCGLLSIDQQAFHSLGKMSHVDLSHNSLICDSIDSL
SHLKGIYLNLAANSINIISPRLLPILSQQSTINLSHNPLDCTCSNIHFLTWYKENLHKLE
GSEETTCANPPSLRGVKLSDVKLSCGITAIGIFFLILFLLLLAILLFFAVKYLLRWKYQH
I
Download sequence
Identical sequences 9598.ENSPTRP00000029007 ENSPTRP00000029007 ENSPTRP00000029007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]