SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029161 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029161
Domain Number 1 Region: 725-938
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-101
Family Thrombospondin C-terminal domain 0.00000012
Further Details:      
 
Domain Number 2 Region: 598-723
Classification Level Classification E-value
Superfamily TSP type-3 repeat 9.02e-35
Family TSP type-3 repeat 0.00000517
Further Details:      
 
Domain Number 3 Region: 214-259
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 1.31e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00096
Further Details:      
 
Domain Number 4 Region: 529-600
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.14e-16
Family TSP type-3 repeat 0.00025
Further Details:      
 
Domain Number 5 Region: 35-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000756
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 6 Region: 479-541
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000575
Family TSP type-3 repeat 0.00021
Further Details:      
 
Domain Number 7 Region: 369-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000383
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 287-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000029161
Domain Number - Region: 419-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00515
Family EGF-type module 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029161   Gene: ENSPTRG00000017031   Transcript: ENSPTRT00000031570
Sequence length 956
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:35414917:35462944:-1 gene:ENSPTRG00000017031 transcript:ENSPTRT00000031570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTPRADAVLLLLVQRLANGGGFPPQVFDLLPSSSQRLNPGALLPVLTDPALNDLYVIST
FKLQTKSSATIFGLYSSTDNSKYFEFTVMGRLNKAILRYLKNDGKVHLVVFNNLQLADGR
RHRILLRLSNLQRGAGSLELYLDCIQVDSIHNLPRAFAGPSQKPETIELRTFQRKPQDFL
EELKLVVRGSLFQVASLQDCFLQQSEPLAATGTGDFNRQFLGQMTQLNQLLGEVKDLLRQ
QVKETSFLRNTIAECQACGPLKFQSPTPSTVVPPAPPAPPTRPPRRCDSNPCFRGVQCTD
SRDGFQCGPCPEGYTGNGITCIDVDECKYHPCYPGVRCINLSPGFRCDACPVGFTGPMVQ
GVGISFAKSNKQVCTDIDECRNGACVPNSICVNTLGSYRCGPCKPGYTGDQIRGCKAERN
CRNPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSARNCK
KDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLIHNVDQRNSDKDIFGDAC
DNCLSVLNNDQKDTDGDGRGDACDDDMDGDGIKNILDNCPKFPNRDQRDKDGDGVGDACD
SCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIGDEC
DDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVGDICESDFDQDQVIDRIDVCPENA
EVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEG
TFHVNTQTDDDYAGFIFGYQDSSSHHMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGP
GEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELV
ADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRFDN
Download sequence
Identical sequences ENSPTRP00000029161 ENSPTRP00000029161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]