SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029170 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000029170
Domain Number - Region: 46-142
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 0.0091
Family Glycerophosphoryl diester phosphodiesterase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029170   Gene: ENSPTRG00000017039   Transcript: ENSPTRT00000031581
Sequence length 276
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:34946100:35000601:-1 gene:ENSPTRG00000017039 transcript:ENSPTRT00000031581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASAGGPGSWSENILEYFLRNSQITAEDGAEITWYHAANHKAQTNEALKSTAHMIEADV
LLPSDGSEHSQPIMAHPPETNSDNTLQEWLTEVMKSNKGIKLDFKSLAAVEPSMMLLENV
KRHLKRPVWINADILPGPNGNSKVIDAKPFLDTVTSFFPDVTFSLGWTTGWHPEKVNEGY
SWTMVKEMEYICNELSQPVTFPVRAALLRQSCSQLLWLLKKSNRYSLTIWTGKNDNYSVE
DLLYIRDHFDKKQVFYDILEPQNHEFKQAIGIKFNL
Download sequence
Identical sequences H2QR59
XP_003822317.1.60992 XP_527209.2.37143 ENSPTRP00000029170 9598.ENSPTRP00000029170 ENSPTRP00000060437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]