SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029197 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029197
Domain Number 1 Region: 3135-3293
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-41
Family C-type lectin domain 0.00000564
Further Details:      
 
Domain Number 2 Region: 144-259
Classification Level Classification E-value
Superfamily C-type lectin-like 8.48e-41
Family Link domain 0.002
Further Details:      
 
Domain Number 3 Region: 252-353
Classification Level Classification E-value
Superfamily C-type lectin-like 1.03e-29
Family Link domain 0.003
Further Details:      
 
Domain Number 4 Region: 28-148
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000707
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 
Domain Number 5 Region: 3294-3352
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000125
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 3091-3131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000286
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029197   Gene: ENSPTRG00000017055   Transcript: ENSPTRT00000031608
Sequence length 3396
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:31822651:31933351:-1 gene:ENSPTRG00000017055 transcript:ENSPTRT00000031608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSE
FLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKL
LASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIA
TPEQLFAAYEDGFEQCDAGWLSDQTVRYPIRAPRVGCYGDKMGKAGVRTYGFRSPQETYD
VYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLS
DASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKEATTIDLSILA
ETASPSLSKEPQMVSDRTTPIIPLVDELPVIPTEFPPVGNIVSFEQKATVQPQAVTDSLA
TKLPTPTGSTKKPWDMDDYSPSASGPLGKLDISEIKEEVLQSTTGVSHYATDSWDGVVED
TQTQESVTQIEQIEVGPLVTSMEILKHIPSKEFPVTETPLVTARMTLESKTEKKMVSTVS
ELVTTGHYGFTLGEEDDEDRTLTVGSDESTLIFDQIPEVITVSKTSEDTIHTQLEDLESV
SASTTVSPLIMPDNNGSSMDDWEERQTSGRITEEFLGKYLSTTPFPSQHRTEIELFPYSG
DKILVEGISTVIYPSLQTEMTHRRERTETLIPEMRTDTYTDEIQEEITKSPFMGKTEEEV
FSGMKLSTSLSEPIHVTESSVEMTKSFDFSTLITKLSAEPTEVRDMEEDFTATPGTTKYD
ENITTVLLAHGTLSVEAATVSKWSWDEDNTTSKPLESTEPSASSKLPPALLTTVGMNGKD
KDIPSFTEDGADEFTLIPDSTQKQLEEVTDEDIAAHGKFTIRFQPTTSIGIAEKSTLRDS
TTEEKVPPITSTEGQVYATMEGSALGEVEDVDLSKPVSTVPQFAHTSEVEGLAFVSYSST
QEPTTYVDSSHTIPLSVIPKTDWGVLVPSVPSEDEVLGEPSQDILVIDQTRLEATISPET
MRTTKITEGTTQEEFPWKEQTAEKPVPALSSTAWTPKEAVTPLDEQEGDGSAYTVSEDEL
LTGSERVPVLETTPVGKIDHSVSYPPGAVTEHKVKTDEVVTLTPRIGPKVSLSPGPEQKY
ETEGSSTTGFTSSLSPFSTHITQLVEETTTEKTSLEDIDLGSGLFEKPKATELIEFSTIK
VTVPSDITTAFSSVDRLHTTSAFKPSSTITKKPPVIDREPGEETTSDMVIIGESTSHVPP
TTLEDIVAKETETDIDREYFTTSSPPATQPTRPPTVEDKEAFGPQALSTPQPPASTKFHP
DINVYIIEVRENKTGRMSDLSVIGHPIDSESKEDEPCSEETDPVHDLMAEILPEFPDIIE
IDLYHSEENEEEEEECANATDVTTTPSVQYINGKHLVTTVPKDPEAAEARRGQFESVAPS
QNFSDSSESDTHPFVIAKTELSTAVQPNESTETTESLEITWKPETYPETSEHFSGGEPDV
FPTVPFHEEFESGTAKKGAESVTERDTEVGHQGREHTEPVSLFPEESSGEIAIDQESQKI
AFARATEVTFGEEVEKSTSVTYTPTIVPSSASAYVSEEEAVTLIGNPWPDDLLSTKESWV
EATPRQVVELSGSSSIPITEGSGEAEEDEDTMFTMVTDLSQRNTTDTLITLDTSRIITES
FFEVPATTIYPVSEQTSAKVVPTKFVSETDTSEWISSTSVEEKKRKEEEGTTGTASTVEV
YSSTQRSDQLILPFELESPNVATSSDSGTRKSFMSLTTPTQSEREMTDSTPVFTETNTLE
NLGAQTTEHSSVHQPGVQEGLTTLPRSPASVFMEQGSGEAAADPETTTVSSFSLNLEYEI
QAEKEAAGTLSPHVETTFSTEPTGLVLSTVMDREVAENITQTSREIVISERLEEPNYGAE
IRGFSTGFPLEEDFSGDFREYSTVSHPIAKEETVMTEGSGDAAFRDTQTSPSTVPTSVHI
SHISDSEGPSSTMVSTSAFPWEEFTSSAEGSGEQLVTVSSSVVPVLPSAVRKFSGTASSI
IDEGLGEVGTVNEIDRRSTILPTAEVEGTKAPVEKEEVKVSGTVSTNFPQTIEPAKLWSR
QEVNPVRQEIESETTSEEQIQEEKSFESPQNSPATEQTIFDSQTFTETELKTTDYSVLTT
KKTYSDDKEMKEEDTSLVNMSTPDPDANGLESYTTLPEATEKSHFFLATALVTESIPAEH
VVTDSPIKKEESTKHFPKGMRPTIQESDTELLFSGLGSGEEVLPTLPTESVNFTEVEQIN
NTLYPHTSQVESTSSDKIEDSNRMENVAKEVGPLVSQTDIFEGSGSVTSTTLIEILSDTG
AEGPTVAPLPFSTDIGHPQNQTLRWAEEIQTSRPQTITEQDSNKNSSTAEINETTASSTD
FLARAYGFEMAKEFVTSAPKPSDLYYEPSGEGSGEVDIVDSFHTSATTQATRQESSTTFV
SDGSLERHPEVPSAKAVTADGFPTVSVMLPLHSEQNKSSPDPTSTLSNTVSYERSTDGSF
RDRFREFEDSTLKPNRKKPTENIIIDLDKEDKDLILTITESTILEILPELTSDKNTIIDI
DHTKPVYEDILGMQTDIDTEVPSEPHDSNDESNDDSTQVQEIYEAAVNLSLTEETFEGSA
DVLASYTQATHDESMTYEDRSQLDHMGFNFTTGIPAPSTETELDVLLPTATSLPIPHKSA
TVIPEIEGIKAEAKALDDMFESSTLSDGQAIADQSEIIPTLGQFERTQEEYEDKKHAGPS
FQPEFSSGAEEALVDHTPYLSIATTHLMDQSLTEVPDVMEGSNPPYYTDTTLAVSTFAKL
SSQTPSSPLTIYSGSEASGHTEIPQPSALPGIDVGSSVMSPQDSFKEIHVNIEATFKPSS
EEYLHITEPPSLSPDTKLEPSEDDGKPELLEEMEASPTELIAVEGTEILQDFQNKTDGQV
SGEAIKMFPTIKTPEAGTVITTADEIELEGATQWPHSTSASATYGVEAGVVPWLSPQTSE
RPTLSSSAEINPETQAALIRGQDSTIAASEQQVAARILDSNNQTTVSPVEFNTEVATPPF
SLLETSNETDFLIGINEESVEGTAIYLPGPDRCKMNPCLNGGTCYPTETSYVCTCVPGYS
GDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQC
YKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWT
DGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPP
VVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQR
TYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR
Download sequence
Identical sequences H2QR70
9598.ENSPTRP00000029197 XP_517667.2.37143 ENSPTRP00000029197 ENSPTRP00000029197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]