SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029199 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029199
Domain Number 1 Region: 318-477
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.47e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000181
Further Details:      
 
Domain Number 2 Region: 156-316
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000393
Further Details:      
 
Domain Number 3 Region: 119-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000982
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 4 Region: 76-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000175
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 24-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000112
Family EGF-type module 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029199   Gene: ENSPTRG00000017057   Transcript: ENSPTRT00000031610
Sequence length 480
Comment pep:known chromosome:CHIMP2.1.4:5:31008301:31457237:1 gene:ENSPTRG00000017057 transcript:ENSPTRT00000031610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRSVAVWLLVGLSLGVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCS
SVVEVASDEEEPTSAGPCIPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI
NECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTH
RALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSP
EYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQV
CRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDK
QGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWT
VYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Download sequence
Identical sequences A0A2I2Y2T5 A0A2I3T8Y9 H2PG16
ENSPTRP00000029199 ENSPTRP00000029199 ENSPPYP00000017457 ENSGGOP00000027726 ENSGGOP00000027726 9598.ENSPTRP00000029199 9600.ENSPPYP00000017457 ENSPPYP00000017457 XP_001146806.1.37143 XP_018883807.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]