SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029200 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029200
Domain Number 1 Region: 308-467
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000181
Further Details:      
 
Domain Number 2 Region: 146-306
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000393
Further Details:      
 
Domain Number 3 Region: 109-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000104
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 4 Region: 65-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000166
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 23-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000491
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029200   Gene: ENSPTRG00000017057   Transcript: ENSPTRT00000031611
Sequence length 470
Comment pep:known chromosome:CHIMP2.1.4:5:31008301:31457237:1 gene:ENSPTRG00000017057 transcript:ENSPTRT00000031611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRSVAVWLLVGLSLGVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCS
SVVEVGPCIPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKN
GGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWY
PYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAY
SNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRME
LLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSG
HNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKD
KVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Download sequence
Identical sequences A0A2I2Y8W9 A0A2I3TLF6 A0A2J8UWZ6
XP_018883808.1.27298 XP_526867.2.37143 ENSPTRP00000029200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]