SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029340 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029340
Domain Number 1 Region: 508-709
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-21
Family SPRY domain 0.0081
Further Details:      
 
Domain Number 2 Region: 204-267
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.66e-16
Family B-box zinc-binding domain 0.00098
Further Details:      
 
Domain Number 3 Region: 431-511
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000206
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 4 Region: 25-64
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000783
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000029340
Domain Number - Region: 251-341
Classification Level Classification E-value
Superfamily Prefoldin 0.0209
Family Prefoldin 0.01
Further Details:      
 
Domain Number - Region: 149-199
Classification Level Classification E-value
Superfamily RING/U-box 0.0339
Family ZZ domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029340   Gene: ENSPTRG00000017145   Transcript: ENSPTRT00000031755
Sequence length 728
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:115615322:115671959:-1 gene:ENSPTRG00000017145 transcript:ENSPTRT00000031755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESGEMSEFGYIMELIAKGKVTIKNIERELICPACKELFTHPLILPCQHSICHKCVKEL
LLTLDDSFNDVGSDNSNQSSPRLRLPSPSMDKIDRINRPGWKRNSLTPRTTVFPCPGCEH
DVDLGERGINGLFRNFTLETIVERYRQAARAATAIMCDLCKPPPQESTKSCMDCSASYCN
ECFKIHHPWGTIKAQHEYVGPTTNFRPKILMCPEHETERINMYCELCRRPVCHLCKLGGN
HANHRVTTMSSAYKTLKEKLSKDIDYLIGKESQVKSQISELNLLMKETECNGERAREEAI
THFEKLFEVLEERKSSVLKAIDSSKKLRLDKFQTQMEEYQGLLENSGLVGYAQEVLKETD
QSCFVQTAKQLHLRIQKATESLKSFRPAAQTSFEDYVVNTSKQTELLGELSFFSTGIDVP
EINEEQSKVYNNALINWHHPEKDKADSYVLEYRKINRDDEMSWNEIEVCGTSKIIQDLEN
SSTYAFRVRAYKGSICSPCSRELILHTPPAPVFSFLFDEKCGYNNEHLLLNLKRDRVESR
AGFNLLLAAERIQVGYYTSLDYIIGDTGITKGKHFWAFRVEPYSYLVKVGVASSDKLQEW
LRSPRDAVSPRYEQDSGHDSGSEDACFDSSQPFTLVTIGMKKFFIPKSPTSSNEPENRVL
PMPTSIGIFLDYDKGKVNFYDMDQMKCLYERQVDCSHTLYPAFALMGSGGIQLEEPITAK
YLEYQEDM
Download sequence
Identical sequences H2QRC2
ENSPTRP00000029340 XP_003826776.1.60992 XP_009447770.1.37143 ENSPTRP00000029340 9598.ENSPTRP00000029340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]