SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029545 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029545
Domain Number 1 Region: 11-152
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 1.7e-46
Family Nucleoside diphosphate kinase, NDK 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000029545
Domain Number - Region: 157-194
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0105
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029545   Gene: ENSPTRG00000017279   Transcript: ENSPTRT00000031976
Sequence length 212
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:138820913:138844863:-1 gene:ENSPTRG00000017279 transcript:ENSPTRT00000031976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEISMPPPQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLHLSPEQCSNFYVE
QYGKMFFPNLTAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTD
DLRNALHGSNDFAAAEREIRFMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQK
PADPLIWLADWLLKNNPNKPKLCHHPVVEEPY
Download sequence
Identical sequences H2PGN4 H2QRJ9
9598.ENSPTRP00000029545 9600.ENSPPYP00000017688 ENSPTRP00000029545 ENSPTRP00000029545 ENSPPYP00000017688 ENSPPYP00000017688 XP_002815970.1.23681 XP_003829280.1.60992 XP_008952857.1.60992 XP_008952858.1.60992 XP_009239365.1.23681 XP_016809373.1.37143 XP_517950.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]