SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029595 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029595
Domain Number 1 Region: 104-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000136
Family EGF-type module 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029595   Gene: ENSPTRG00000017311   Transcript: ENSPTRT00000032031
Sequence length 208
Comment pep:known chromosome:CHIMP2.1.4:5:141056052:141069793:-1 gene:ENSPTRG00000017311 transcript:ENSPTRT00000032031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAATSNPDPPTVSTDQLLPLGGGRDRK
VRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH
Download sequence
Identical sequences H2QRM1
ENSPTRP00000029595 XP_001137119.1.37143 XP_003829241.1.60992 9598.ENSPTRP00000029595 ENSPTRP00000029595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]