SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029618 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029618
Domain Number 1 Region: 57-393
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.59e-80
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000193
Further Details:      
 
Domain Number 2 Region: 407-500
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 6.71e-20
Family Anticodon-binding domain of Class II aaRS 0.0044
Further Details:      
 
Domain Number 3 Region: 5-57
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.000000000208
Family a tRNA synthase domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029618   Gene: ENSPTRG00000017325   Transcript: ENSPTRT00000032055
Sequence length 509
Comment pep:known chromosome:CHIMP2.1.4:5:141401350:141420083:-1 gene:ENSPTRG00000017325 transcript:ENSPTRT00000032055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPK
GTRDYSPRQMAVREKVFDIIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQ
GGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAG
NFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDK
LDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLG
DLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAG
GRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKL
LEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRS
VTSREEVDVRREDLVEEIKRRTGQPLCIC
Download sequence
Identical sequences G2HG51
ENSPTRP00000029618 NP_001233308.1.37143 XP_003829211.1.60992 ENSPTRP00000029618 9598.ENSPTRP00000029618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]