SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029619 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029619
Domain Number 1 Region: 56-394
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.02e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000256
Further Details:      
 
Domain Number 2 Region: 408-503
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 8.67e-20
Family Anticodon-binding domain of Class II aaRS 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029619   Gene: ENSPTRG00000017326   Transcript: ENSPTRT00000032056
Sequence length 506
Comment pep:known chromosome:CHIMP2.1.4:5:141419654:141427525:1 gene:ENSPTRG00000017326 transcript:ENSPTRT00000032056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLGLLPRRAWASLLSQLLRPPCASCTGAVRCQSQVAEAVLTSQLKAHQEKPNFIIKTP
KGTRDLSPQHMVVREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGEDSGLMYDLKD
QGGELLSLRYDLTVPFARYLAMNKVKKMKRYHVGKVWRRESPTIVQGRYREFCQCDFDIA
GQFDPMIPDAECLKIMCEILSGLQLGDFLIKVNDRRIVDGMFAVCGVPESKFRAICSSID
KLDKMAWKDVRHEMVVKKGLAPEVADRIGDYVQCHGGVSLVEQMFQDPRLSQNKQALEGL
GDLKLLFEYLTLFGIADKISFDLSLARGLDYYTGVIYEAVLLQTPTQAGEEPLNVGSVAA
GGRYDGLVGMFDPKGHKVPCVGLSIGVERIFYIVEQRMKTKGEKVRTTETQVFVATPQKN
FLQERLKLIAELWDSGIKAEMLYKNNPKLLTQLHYCESTGIPLVVIIGEQELKEGVIKIR
SVASREEVAIKRENFVAEIQKRLSES
Download sequence
Identical sequences H2QRM9 P49590
9598.ENSPTRP00000029619 9606.ENSP00000230771 ENSPTRP00000029619 gi|15029520|ref|NP_036340.1| ENSP00000230771 NP_036340.1.87134 NP_036340.1.92137 XP_009448091.1.37143 XP_517980.3.37143 HR6658 hsi002006231.1 ENSPTRP00000029619 ENSP00000230771 ENSP00000230771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]