SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029730 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029730
Domain Number 1 Region: 28-148,190-346
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.41e-20
Family FAD-linked reductases, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029730   Gene: ENSPTRG00000017397   Transcript: ENSPTRT00000032184
Sequence length 494
Comment pep:known chromosome:CHIMP2.1.4:5:150202744:150214391:1 gene:ENSPTRG00000017397 transcript:ENSPTRT00000032184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAAPLLAALTALLAAAAAGGDAPPGKIAVVGAGIGGSAVAHFLQQHFGPRVQIDVYEK
GTMGGRLATISVNKQHYESGAASFHSLSLHMQDFVKLLGLRHRREVVGRSAIFGGEHFVL
EETDWYLLNLFRLWWHYGISFLRLQMWVEEVMEKFMRIYKYQAHGYAFSGVEELLYSLGE
STFVNMTQHSVAESLLQVGVTQRFIDDVVSAVLRASYGQSAAMPAFAGAMSLAGAQGSLW
SVEGGNKLVCSGLLKLTKANVIHATVTSVTLHSTEGKALYQVAYENEVGNSSDFYDIVVI
ATPLHLDNSSSNLTFAGFHPPIDDVQGSFQPTVVSLVHGYLNSSYFGFPDPKLFPFANIL
TTDFPSFFCTLDNICPVNISASFRRKQPQEAAVWRVQSPKPLFRTQLKTLFRSYYSVQTA
EWQAHPLYGSRPTLPRFALHDQLFYLNALEWAASSVEVMAVAAKNVALLAYNRWYQDLDK
IDQKDLMHKVKTEL
Download sequence
Identical sequences H2QRR8
ENSPTRP00000029730 XP_001163338.1.37143 ENSPTRP00000029730 9598.ENSPTRP00000029730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]