SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029740 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029740
Domain Number 1 Region: 483-834
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.5e-113
Family PDEase 0.000000248
Further Details:      
 
Domain Number 2 Region: 55-253
Classification Level Classification E-value
Superfamily GAF domain-like 1.37e-31
Family GAF domain 0.00056
Further Details:      
 
Domain Number 3 Region: 238-291,323-459
Classification Level Classification E-value
Superfamily GAF domain-like 6.67e-30
Family GAF domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029740   Gene: ENSPTRG00000002769   Transcript: ENSPTRT00000032194
Sequence length 858
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:93177122:93230220:1 gene:ENSPTRG00000002769 transcript:ENSPTRT00000032194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEINQDAVEKYLEENPQFAKEYFDRKLRVEVLGEIFKNSQVPVQSSMSFSELTQVEESA
LCLELLWTVQEEGGTPEQGVHRALQRLAHLLQADRCSMFLCRSRNGIPEVASRLLDVTPT
SKFEDNLVGPDKEVVFPLDIGIVGWAAHTKKTHNVPDVKKNSHFSDFMDKQTGYVTKNLL
ATPIVVGKEVLAVIMAVNKVNASEFSKQDEEVFSKYLNFVSIILRLHHTSYMYNIESRRS
QILMWSANKVFEELTDVERQFHKALYTVRTYLNCERYSIGLLDMTKEKEFYDEWPIKLGE
VEPYKGPKTPDGREVNFYKIIDYILHGKEEIKVIPTPPADHWTLISGLPTYVAENGFICN
MMNAPADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEY
ITETLTQFLGWSLLNTDTYDKMNKLENRKDIAQEMLMNQTKATPEEIKSILKFQEKLNVD
VIDDCEEKQLVAILKEDLPDPRSAELYEFRFSDFPLTEHGLIKCGIRLFFEINVVEKFKV
PVEVLTRWMYTVRKGYRAVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAF
CHDIDHRGTNNLYQMKSTSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFET
VIHLFEVAIIATDLALYFKKRTMFQKIVDACEQMQTEEEAIKYVTVDPTKKEIIMAMMMT
ACDLSAITKPWEVQSQVALMVANEFWEQGDLERTVLQQQPIPMMDRNKRDELPKLQVGFI
DFVCTFVYKEFSRFHKEITPMLSGLQNNRVEWKSLADEYDAKMKVIEEEAKKQEGGAEKA
AEDSGGGNDKKSKTCLML
Download sequence
Identical sequences H2QRS3
ENSPTRP00000029740 XP_001148438.1.37143 XP_003825420.1.60992 ENSPTRP00000029740 9598.ENSPTRP00000029740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]