SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029741 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029741
Domain Number 1 Region: 572-602,641-719
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.24e-16
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000029741
Domain Number - Region: 199-267
Classification Level Classification E-value
Superfamily Dhaf3308-like 0.0876
Family Dhaf3308-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029741   Gene: ENSPTRG00000017405   Transcript: ENSPTRT00000032195
Sequence length 739
Comment pep:known chromosome:CHIMP2.1.4:5:150813721:150841400:1 gene:ENSPTRG00000017405 transcript:ENSPTRT00000032195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSESKEQHDVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQE
KSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNILGDVMSGLIVGI
LLVPQSIAYSLLAGQEPVYGLYTSFFASIIYFLLGTSRHISVGIFGVLCLMIGETVDREL
QKAGYDNAHSAPSLGMVSNGSTLLNHTSDRICDKSCYAIMVGSTVTFIAGVYQVAMGFFQ
VGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLNLPRTNGVGSLITTWIHVFRNIHKT
NLCDLITSLLCLLVLLPTKELNEHFKSKLKAPIPIELVVVVAATLASHFGKLHENYNSSI
AGHIPTGFMPPKVPEWNLIPSVAVDAIAISIIGFAITVSLSEMFAKKHGYTVKANQEMYA
IGFCNIIPSFFHCFTTSAALAKTLVKESTGCHTQLSGVVTALVLLLVLLVIAPLFYSLQK
SVLGVITIVNLRGALRKFRDLPKMWSISRMDTVIWFVTMLSSALLSTEIGLLVGVCFSMF
CVILRTQKPKSSLLGLVEESEVFESVSAYKNLQTKPGIKIFRFVAPLYYINKECFKSALY
KQTVNPILIKVAWKKAAKRKIKEKVVTLGGIQDEMSVQLSHDPLELHTIVIDCSAIQFLD
TAGIHTLKEVRRDYEAIGIQVLLAQCNPSVRDSLINGEYCKKEEENLLFYSVYEAMAFAE
VSKNQKGVCVPNGLSLSSD
Download sequence
Identical sequences H2QRS4
ENSPTRP00000029741 9598.ENSPTRP00000029741 ENSPTRP00000029741 XP_016809513.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]