SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029789 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029789
Domain Number 1 Region: 153-301
Classification Level Classification E-value
Superfamily EF-hand 8.11e-53
Family Osteonectin 0.0000000717
Further Details:      
 
Domain Number 2 Region: 95-150
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000152
Family Ovomucoid domain III-like 0.0000355
Further Details:      
 
Domain Number 3 Region: 70-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000122
Family Follistatin (FS) module N-terminal domain, FS-N 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029789   Gene: ENSPTRG00000017436   Transcript: ENSPTRT00000032245
Sequence length 303
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:152529597:152555106:-1 gene:ENSPTRG00000017436 transcript:ENSPTRT00000032245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAE
ETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFD
SSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYE
RDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQ
HPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKD
LVI
Download sequence
Identical sequences A0A2J8X6E5 A0A2K5K968 A0A2K6MX34 A0A2K6PQ30 G1S383 H2QRU3 P09486 Q5R767
ENSP00000231061 ENSPTRP00000029789 gi|4507171|ref|NP_003109.1| ENSP00000231061 ENSNLEP00000019971 NP_003109.1.87134 NP_003109.1.92137 XP_001168719.1.37143 XP_003276595.1.23891 XP_008952671.1.60992 XP_008952672.1.60992 XP_010356959.1.97406 XP_011787019.1.43180 XP_017731219.1.44346 ENSPTRP00000029789 9598.ENSPTRP00000029789 9606.ENSP00000231061 ENSP00000231061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]