SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029826 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029826
Domain Number 1 Region: 25-113
Classification Level Classification E-value
Superfamily Immunoglobulin 9.35e-18
Family V set domains (antibody variable domain-like) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029826   Gene: ENSPTRG00000017461   Transcript: ENSPTRT00000032283
Sequence length 301
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:157958850:157982738:-1 gene:ENSPTRG00000017461 transcript:ENSPTRT00000032283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCLYTPAAPGNLVPVCWGKGACPV
FKCGNVVLSTDERDVNYRTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGLMND
EKFNLKLVIKPAKVTPAPTLQRDFTATFPRMLTTRGHGPAETQTLGSLPDINLTQISTLA
SELRDSRLANDLRDSGATIRIGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLI
SLANLPPSGLANAVAEGIRSEENIYTIEENVYEVEEPNEYYCYVSSGQQPSQPLGCRFAM
P
Download sequence
Identical sequences H2QRW0
9598.ENSPTRP00000029826 ENSPTRP00000029826 ENSPTRP00000029826 XP_009448319.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]