SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029905 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029905
Domain Number 1 Region: 1151-1190,1223-1441
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-22
Family YWTD domain 0.012
Further Details:      
 
Domain Number 2 Region: 932-1007
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000922
Family Pre-dockerin domain 0.057
Further Details:      
 
Domain Number 3 Region: 1339-1385,1413-1431,1458-1571
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00000534
Family YVTN repeat 0.048
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000029905
Domain Number - Region: 676-701
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000492
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 773-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00105
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 743-767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00199
Family EGF-type module 0.096
Further Details:      
 
Domain Number - Region: 609-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00304
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 808-848
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00347
Family EGF-type module 0.084
Further Details:      
 
Domain Number - Region: 644-668
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00377
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 579-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0481
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029905   Gene: ENSPTRG00000017505   Transcript: ENSPTRT00000032364
Sequence length 2599
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:168282885:169263389:1 gene:ENSPTRG00000017505 transcript:ENSPTRT00000032364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVKDRRHRSLTRGRCGKECRYTSSSLDSEDCRVPTQKSYSSSETLKAYDHDSRMHYGNR
VTDLVHRESDEFPRQGTNFTLAELGICEPSPHRSGYCSDMGILHQGYSLSTGSDADSDTE
GGMSPEHAIRLWGRGIKSRRSSGLSSRENSALTLTDSDNENKSDDENGRPIPPTSSPSLL
PSAQLPSSHNPPPVSCQMPLLDSNTSHQIMDTNPDEEFSPNSYLLRACSGPQQASSSGPP
NHHSQSTLRPPLPPPHNHTLSHHHSSANSLNRNSLTNRRSQIHAPAPAPNDLATTPESVQ
LQDSWVLNSNVPLETRHFLFKTSSGSTPLFSSSSPGYPLTSGTVYTPPPRLLPRNTFSRK
AFKLKKPSKYCSWKCAALSAIAAALLLAILLAYFIAMHLLGLNWQLQPADGHTFNNGIRT
GLPGNDDVATMPSGGKVPWSLKNSSIDSGEAEVGRRVTQEVPPGVFWRSQIHISQPQFLK
FNISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVVESPRERRSIQTLVQNEAVF
VQYLDVGLWHLAFYNDGKDKEMVSFNTVVLDSVQDCPRNCHGNGECVSGVCHCFPGFLGA
DCAKAACPVLCSGNGQYSKGTCQCYSGWKGAECDVPMNQCIDPSCGGHGSCIDGNCVCSA
GYKGEHCEEVDCLDPTCSSHGVCVNGECLCSPGWGGLNCELARVQCPDQCSGHGTYLPDT
GLCSCDPNWMGPDCSVEVCSVDCGTHGVCIGGACRCEEGWTGAACDQRVCHPRCIEHGTC
KDGKCECREGWNGEHCTIGRQTAGTETDGCPDLCNGNGRCTLGQNSWQCVCQTGWRGPGC
NVAMETSCADNKDNEGDGLVDCLDPDCCLQSACQNSLLCRGSRDPLDIIQQGQTDWPAVK
SFYDRIKLLAGKDSTHIIPGENPFNSSLVSLIRGQVVTTDGTPLVGVNVSFVKYPKYGYT
ITRQDGTFDLIANGGASLTLHFERAPFMSQERTVWLPWNSFYAMDTLVMKTEENSIPSCD
LSGFVRPDPIIISSPLSTFFSAAPGQNPIVPETQVLHEEIELPGSNVKLRYLSSRTAGYK
SLLKITMTQSTVPLNLIRVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLS
DAVNKEFKHSNNPAHKYYLAVDPVSGSLYVSDTNSRRIYRVKSLSGTKDLAGNSEVVAGT
GEQCLPFDEARCGDGGKAIDATLMSPRGIAVDKNGLMYFVDATMIRKVDQNGIISTLLGS
NDLTAVRPLSCDSSMDVAQVRLEWPTDLAVNPMDNSLYVLENNVILRITENHQVSIIAGR
PMHCQVPGIDYSLSKLAIHSALESASAIAISHTGVLYITETDEKKINRLRQVTTNGEICL
LAGAASDCDCKNDVNCNCYSGDDAYATDAILNSPSSLAVAPDGTIYIADLGNIRIRAVSK
NKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTYSTDNDVTELIDNN
GNSLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGLKVVSTQNLELGLMTYDGNTGLLATK
SDETGWTTFYDYDHEGRLTNVTRPTGVVTSLHREMEKSITIDIENSNRDDDVTVITNLSS
VEASYTVVQDQVRNSYQLCNNGTLRVMYANGMGVSFHSEPHVLAGTITPTIGRCNISLPM
ENGLNSIEWRLRKEQIKGKVTIFGRKLRVHGRNLLSIDYDRNIRTEKIYDDHRKFTLRII
YDQVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFADGKVW
SYSYLDKSMVLLLQSQRQYIFEYDSSDRLLAVTMPSVARHSMSTHTSIGYIRNIYNPPES
NASVIFDYSDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGYDETTGVLKMV
NLQSGGFSCTIRYRKIGPLVDKQIYRFSEEGMVNARFDYTYHDNSFRIASIKPVISETPL
PVDLYRYDEISGKVEHFGKFGVIYYDINQIITTAVMTLSKHFDTHGRIKEVQYEMFRSLM
YWMTVQYDSMGRVIKRELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNL
HLLNPGNSVRLMPLRYDLRDRITRLGDVQYKIDDDGYLCQRGSDIFEYNSKGLLTRAYNK
ASGWSVQYRYDGVGRRASLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYG
EIYYDSNPDFQMVIGFHGGLYDPLTKLVHFTQRDYDVLAGRWTSPDYTMWKNVGKEPAPF
NLYMFKSNNPLSSELDLKNYVTDVKSWLVMFGFQLSNIIPGFPRAKMYFVPPPYELSESQ
ASENGQLITGVQQTTERHNQAFMALEGQVITKKLHASIREKAGHWFATTTPIIGKGIMFA
IKEGRVTTGVSSIASEDSRKVASVLNNAYYLDKMHYSIEGKDTHYFVKIGSADGDLVTLG
TTIGRKVLESGVNVTVSQPTLLVNGRTRRFTNIEFQYSTLLLSIRYGLTPDTLDEEKARV
LDQARQRALGTAWAKEQQKARDGREGSRLWTEGEKQQLLSTGRVQGYEGYYVLPVEQYPE
LADSSSNIQFLRQNEMGKR
Download sequence
Identical sequences ENSPTRP00000029905 ENSPTRP00000029905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]