SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029920 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029920
Domain Number 1 Region: 122-217
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.77e-40
Family Forkhead DNA-binding domain 0.0000244
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000029920
Domain Number - Region: 7-87,244-277
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00139
Family beta-sandwich domain of Sec23/24 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029920   Gene: ENSPTRG00000017514   Transcript: ENSPTRT00000032380
Sequence length 378
Comment pep:novel chromosome:CHIMP2.1.4:5:171114033:171117876:1 gene:ENSPTRG00000017514 transcript:ENSPTRT00000032380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPN
PYLWLNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMK
LVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDC
FKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDVSSSTGSLALEKTESSLLV
DSPKTTEPQDILDGASPGGTTSSPEKRPSPPPSGTPCLNSFLSSMTAYVSGGSPTSRPLV
TPGLSPEPSDKTGQNSLSFNSFSPLTNLSNHSGGGDWANPMPTNTLSYGGSVLSQFSPHF
YNSVNTSGVLYPREGTEV
Download sequence
Identical sequences H2QRZ5
9598.ENSPTRP00000029920 ENSPTRP00000029920 ENSPTRP00000029920 XP_527110.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]