SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029923 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029923
Domain Number 1 Region: 403-513
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-22
Family SH2 domain 0.0007
Further Details:      
 
Domain Number 2 Region: 9-73
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000169
Family SAM (sterile alpha motif) domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029923   Gene: ENSPTRG00000017517   Transcript: ENSPTRT00000032383
Sequence length 533
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:171250811:171300408:-1 gene:ENSPTRG00000017517 transcript:ENSPTRT00000032383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKL
RVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQ
DGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSG
KTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTK
PPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRPLGEHLPKIQKPPLPPTTERHERSSPL
PGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPSPMNSLPSSHM
PGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPLPLPNKPRPPSPAEEENSLNE
EWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKES
QVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP
Download sequence
Identical sequences A0A2I3S4L7
ENSPTRP00000029923 ENSPTRP00000029923 XP_001150122.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]