SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029931 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029931
Domain Number 1 Region: 226-518
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.65e-75
Family WD40-repeat 0.0000000000666
Further Details:      
 
Domain Number 2 Region: 112-224
Classification Level Classification E-value
Superfamily F-box domain 6.15e-27
Family F-box domain 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029931   Gene: ENSPTRG00000017526   Transcript: ENSPTRT00000032395
Sequence length 542
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:172869390:173016591:-1 gene:ENSPTRG00000017526 transcript:ENSPTRT00000032395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVS
RKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFI
TALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKG
LSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENS
KGVYCLQYDDEKIISGLRDNSIKIWDKSSLECLKVLTGHTGSVLCLQYDERVIVTGSSDS
TVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLV
GHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGS
SDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPA
STLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYI
SR
Download sequence
Identical sequences A0A2K5Z2A9 H2QS02
ENSPTRP00000029931 ENSPTRP00000029931 XP_003814036.1.60992 XP_011843098.1.47321 XP_518097.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]