SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030027 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030027
Domain Number 1 Region: 53-276
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.53e-73
Family Lectin leg-like 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030027   Gene: ENSPTRG00000017580   Transcript: ENSPTRT00000032497
Sequence length 356
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:178407505:178428046:-1 gene:ENSPTRG00000017580 transcript:ENSPTRT00000032497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEGWIWCWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSL
IKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKV
HGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVM
VNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCI
DITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLK
SPKDNVDDPTGNFRSGPLTGWRVFLLLLCALLGIVVCAVVGAVVFQKRQERNKRFY
Download sequence
Identical sequences 9598.ENSPTRP00000030027 ENSPTRP00000030027 ENSPTRP00000030027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]