SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030143 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030143
Domain Number 1 Region: 280-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-54
Family SPRY domain 0.0000279
Further Details:      
 
Domain Number 2 Region: 20-131
Classification Level Classification E-value
Superfamily Immunoglobulin 2.34e-20
Family V set domains (antibody variable domain-like) 0.00014
Further Details:      
 
Domain Number 3 Region: 141-209
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000263
Family I set domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030143   Gene: ENSPTRG00000042502   Transcript: ENSPTRT00000032622
Sequence length 473
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:182141039:182158273:1 gene:ENSPTRG00000042502 transcript:ENSPTRT00000032622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFVLILVLSFYELVSGQWQVTGPGKFVQALVGEDAVLSCSLFPETSAEAMEVRFFRNQF
HAVVHLYRDGEDWESKQMPQYRGRTEFVKDSIAGGHVSLRLKNITPSDIGLYGCWFSSQI
YDEEATWELRVAALGSLPLISIVGYVDGGIQLLCLSSGWFPQPTAKWKGPQGQDLSSDSR
ANADGHSLYDVEISIIVQEDSGSILCSIHLAEWSHEVESKVLIGETFFQPSPWRLASILL
GLLCGALCAVVMGMIIVFFKSKGKIQAELDWRRKHGQAELRDARKHAVEVTLDPETAHPQ
LCVSDLKTVTHRKAPQEVPHSEKRFTRKSVVASQGFRAGKHYWEVDVGQNVGWYVGVCRD
DVDRGKNSVTLSPSNGYWVLRLTTEHLYFTFNPHLISLPPSTPPTRVGVFLDYEGGTISF
FNTNDQSLIYTLLTCQFEGLLRPYIQHAMYDKERGTPIFICPVSRGSEREDPA
Download sequence
Identical sequences ENSPTRP00000030143 ENSPTRP00000030143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]