SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030422 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030422
Domain Number 1 Region: 332-513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-66
Family SPRY domain 0.0000104
Further Details:      
 
Domain Number 2 Region: 31-143
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-19
Family V set domains (antibody variable domain-like) 0.0002
Further Details:      
 
Domain Number 3 Region: 156-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000186
Family C2 set domains 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030422   Gene: ENSPTRG00000017830   Transcript: ENSPTRT00000032935
Sequence length 584
Comment pep:novel chromosome:CHIMP2.1.4:6:26708513:26721422:1 gene:ENSPTRG00000017830 transcript:ENSPTRT00000032935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMASSLAFLLLNFHVSLFLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSA
ETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASD
SGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSIGWYPQPQIKWS
DTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADP
FFRSAQPWIAALAGTLPISLLLLAGASYFLWRQQKEKIALSRETEREREMKEMGYAATEQ
EISLREKLQEELKWRKIQYMARGEKSLAYHEWKMALFKPADVILDPDTANAILLVSEDQR
SVQRAEEPRDLPDNPERFEWRYCVLGCENFTSGRHYWEVEVGDRKEWHIGVCSKNVERKK
GWVKMTPENGYWTMGLTDGNKYRALTEPRTNLKLPEPPRKVGIFLDYETGEISFYNATDG
SHIYTFPHASFSEPLYPVFRILTLEPIALTICPIPKEVESSPDPDLVPDHSLETPVTPGL
ANESGEPQAEVTSLLLPAQPGAEVSPSATTNQNHKLQARTEALY
Download sequence
Identical sequences H2QSH5
9598.ENSPTRP00000030422 ENSPTRP00000030422 ENSPTRP00000030422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]