SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030688 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000030688
Domain Number - Region: 23-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0158
Family I set domains 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030688   Gene: ENSPTRG00000017980   Transcript: ENSPTRT00000033215
Sequence length 241
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:32003380:32006751:1 gene:ENSPTRG00000017980 transcript:ENSPTRT00000033215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCVGVSHPIRWVWAPSFPACKGLSKGR
RPILWASSSGTPTVPPLQPFFGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVL
HVLGDRTYCKAPGPTHGSVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRF
APLVKTEPQRPVKEEEPKIPGDLDQEPSLLYADLDHLALSRPRRLSTADPADASTIYAVV
V
Download sequence
Identical sequences A0A2J8NY06
ENSPTRP00000030688 ENSPTRP00000030688 XP_001158905.1.37143 XP_003831614.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]