SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030715 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030715
Domain Number 1 Region: 203-472
Classification Level Classification E-value
Superfamily vWA-like 1.25e-60
Family Integrin A (or I) domain 0.00000000155
Further Details:      
 
Domain Number 2 Region: 474-758
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.46e-60
Family Eukaryotic proteases 0.0000000000722
Further Details:      
 
Domain Number 3 Region: 97-158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000334
Family Complement control module/SCR domain 0.000017
Further Details:      
 
Domain Number 4 Region: 164-220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000639
Family Complement control module/SCR domain 0.0000237
Further Details:      
 
Domain Number 5 Region: 44-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000334
Family Complement control module/SCR domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030715   Gene: ENSPTRG00000017995   Transcript: ENSPTRT00000033244
Sequence length 764
Comment pep:known chromosome:CHIMP2.1.4:6:32225053:32231180:1 gene:ENSPTRG00000017995 transcript:ENSPTRT00000033244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSNLSPQLCLMPFILGLLSGGVTTTPWPLAQPQESCSLEGVEIKGGSFRLLQEGQALEY
VCPSGFYPYPVQTRTCRSTGSWSTLKTQVQKTVRKAECRAIHCPRPHDFENGEYWPRSPY
YNVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQ
YRLEDSVTYHCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTE
TIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKV
ASYGVKPRYGLVTYATHPKIWVKVSDPDSSNADWVTKQLNEINYEDHKLKSGTNTKKALQ
AVYSMMSWPDDIPPEGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPRE
DYLDVYVFGVGPLVNQVNINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGM
VWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVS
VGGEKRDLEIEVVLFHPNYNINGKKAAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCT
EGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDA
QYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWG
VVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLGFL
Download sequence
Identical sequences K7D3S4 Q864W0
ENSPTRP00000030715 9598.ENSPTRP00000030715 NP_001009169.1.37143 ENSPTRP00000030715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]