SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031017 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031017
Domain Number 1 Region: 26-116
Classification Level Classification E-value
Superfamily Immunoglobulin 6.69e-16
Family V set domains (antibody variable domain-like) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031017   Gene: ENSPTRG00000018149   Transcript: ENSPTRT00000033564
Sequence length 230
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:41721646:41726326:-1 gene:ENSPTRG00000018149 transcript:ENSPTRT00000033564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPC
QRVVSTHNLWLLSFLRRRNGSTAITDDTLGGTLTITLRNLQPRDAGLYQCQSLHGSEADT
LRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLA
CIFLIKILAASALWAAAWHGQKPGTHPPSEPDCGHDPGYQLQTLPGLRDT
Download sequence
Identical sequences H2QSZ0
ENSPTRP00000031017 ENSPTRP00000031017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]