SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031071 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031071
Domain Number 1 Region: 1299-1403,1457-1624
Classification Level Classification E-value
Superfamily Cullin homology domain 7.46e-41
Family Cullin homology domain 0.00045
Further Details:      
 
Domain Number 2 Region: 862-1054
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.79e-35
Family APC10-like 0.0055
Further Details:      
 
Domain Number 3 Region: 444-518
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.41e-32
Family CPH domain 0.0000057
Further Details:      
 
Domain Number 4 Region: 213-250,747-826,1347-1384,1434-1492
Classification Level Classification E-value
Superfamily ARM repeat 0.00000667
Family GUN4-associated domain 0.041
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000031071
Domain Number - Region: 1634-1730
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.015
Family Penicillinase repressor 0.036
Further Details:      
 
Domain Number - Region: 1046-1155
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.0628
Family Cullin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031071   Gene: ENSPTRG00000018185   Transcript: ENSPTRT00000033622
Sequence length 1782
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:43659189:43676534:-1 gene:ENSPTRG00000018185 transcript:ENSPTRT00000033622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGFWLAEPLAGTGPHPAPVAADSRGCSSVPRRHAPSRLSVSTPSRGPGARMVGELRYR
EFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDCKAEHILLW
MSKDEIYANCHKMLGEDGQVIGPSQESAGEVGALDKSVLEEMETDVKSLIQRALRQLEEC
VGTIPSAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWSAGRMIQAL
SSHDAGEGQCGEEGKAGEGLGRLRDSQDTVAGASDLIRTRTQILLSLSQQEAIEKHLDFD
SRCALLALFAQATLSEHPMSFEGIQLPQVPGRVLFSLVKRYLHVTSLLDQLNDSAAEPGA
QNTSAPEELSGERGQLELEFSMAMGTLISELVQAMRWDQASDRPRSSARSPGSIFQPQLA
DVSPGLPAAQAQPSFRRSRRFRPRSEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGD
EGEFRQSNNGVPPVQVFWESTGRTYWVHWHMLEILGFEEDIEDMVEADEYQGAVASRVLG
RALPAWRWRPMTELYAVPYVLPEDEDTEECEHLTLAEWWELLFFIKKLDGPDHQEVLQIL
QENLDGEILDDEILAELAVPIELAQDLLLTLPQRLNDSALRDLINCHVYKKYGPEALAGN
QAYPSLLEAQEDVLLLEAQAQAKDSEDAAKVEAKEPPSQSPNTPLQRLVEGYGPAGKILL
DLEQALSSEGTQENKVKPLLLQLQRQPQPFLALMQSLDTPETNRTLHLTVLRILKQLVDF
PEALLLPWHEAVDACMACLRSPNTDREVLQELIFFLHRLTSVSRDYAVVLNQLGARDAIS
KALEKHLGKLELAQELRDMVFKCEKHAHLYRKLITNILGGCIQMVLGQIEDHRRTHRPIN
IPFFDVFLRYLCQGSSVEVKEDKCWEKVEVSSNPHRASKLTDHNPKTYWESNGSAGSHYI
TLHMRQGILIRQLTLLVASEDSSYMPARVVVCGGDSTSSLHTELNSVNVMPSASRVILLE
NLTRFWPIIQIRIKRCQQGGIDTRIRGLEILGPKPTFWPVFREQLCRHTRLFYMVRAQAW
SQDMAEDRRSLLHLSSRLNGALRQEQNFADRFLPDDEAAQALGKTCWEALVSPVVQNITS
PDEDGISPLGWLLDQYLECQEAVFNPQSRGPAFFSRVRRLTHLLVHVEPCEAPPPVVATP
RPKGRNRSHDWSSLATRGLPSSIMRNLTRCWRAVVEKQVNNFLTSSWRDDDFVPRYCEHF
NILQNSSSELFGPRAAFLLALQNGCAGAFLKLPFLKAAHVSEQFARHIDQQIQGSRIGGA
QEMERLAQLQQCLQAVLIFSGLEIATTFEHYYQHYMADRLLGVVSSWLEGAVLEQIGPCF
PNRLPQQMLQSLSTSKELQRQFHVYQLQQLDQELLKLEDTEKKIQVGLGASGKEHKSEKE
EEAGAAAVVDVAEGEEEEEENEDLYYEGAMPEVSVLVLSRHSWPVASICHTLNPRTCLPS
YLRGTLNRYSNFYNKSQSHPALERGSQRRLQWTWLGWAELQFGNQTLHVSTVQMWLLLYL
NDLKAVSVESLLALSGLSADMLNQAIGPLTSSRGPLDLHEQKDIPGGVLKIRDGSKEPRS
RWDIVRLIPPQTYLQAEGEEGRNLEKRRNLLNCLIVRILKAHGDEGLHIDQLVCLVLEAW
QKGPCPPRGLVSSLGKGSACSSTDVLSCILHLLGKGTLRRHDDRPQVLSYAVPVTVMEPH
TESLNPGSSGPNPPLTFHTLQIRSRGVPYASCTATQSFSTFR
Download sequence
Identical sequences H2QT18
ENSPTRP00000031071 ENSPTRP00000031071 XP_003311343.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]