SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031080 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031080
Domain Number 1 Region: 778-1059
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-69
Family Protein kinases, catalytic subunit 0.00000113
Further Details:      
 
Domain Number 2 Region: 594-687
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 412-501
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-20
Family I set domains 0.022
Further Details:      
 
Domain Number 4 Region: 126-219
Classification Level Classification E-value
Superfamily Immunoglobulin 4.32e-18
Family I set domains 0.026
Further Details:      
 
Domain Number 5 Region: 329-418
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000103
Family I set domains 0.016
Further Details:      
 
Domain Number 6 Region: 502-589
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000178
Family I set domains 0.02
Further Details:      
 
Domain Number 7 Region: 227-315
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000212
Family I set domains 0.066
Further Details:      
 
Domain Number 8 Region: 31-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000192
Family V set domains (antibody variable domain-like) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031080   Gene: ENSPTRG00000018188   Transcript: ENSPTRT00000033631
Sequence length 1070
Comment pep:known chromosome:CHIMP2.1.4:6:43700037:43788255:1 gene:ENSPTRG00000018188 transcript:ENSPTRT00000033631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAARGSPARPRRLPLLSVLLLPLLGGTQTAIVFIKQPSSQDALQGRRALLRCEVEAPGP
VHVYWLLDGAPVQDTERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEALSANASFN
IKWIEAGPVVLKHPASEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDGQSNHTVSS
KERNLTLRPAGPEHSGLYSCCAHNAFGQACSSQNFTLSIADESFARVVLAPQDVVVARNE
EAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATVFANGSLLLTQVRPRNAGIYR
CIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLPEPSVWWEHAG
VRLPTHGRVYQKGHELVLANIAESDAGVYTCHAANLAGQRRQDVNITVATVPSWLKKPQD
SQLEEGKPGYLDCQTQATPKPTVVWYRNQMLISEDSRFEVFKNGTLRINNVEVYDGTWYR
CVSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSATGREKPTIKWERAD
GSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPER
TTVYQGHTALLQCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSG
RYTCIAGNSCNIKHTEAPLYVVDKPVPEESEGPGSPPPYKMIQTIGLSVGAAVAYIIAVL
GLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATN
KRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQ
LDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQ
PLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEY
YHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQ
AGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSPVDSKP
Download sequence
Identical sequences H2QT20
XP_003833315.1.60992 XP_518486.2.37143 9598.ENSPTRP00000031080 ENSPTRP00000031080 ENSPTRP00000031080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]