SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031087 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031087
Domain Number 1 Region: 1544-1648,1682-1826
Classification Level Classification E-value
Superfamily Cullin homology domain 8.37e-41
Family Cullin homology domain 0.00098
Further Details:      
 
Domain Number 2 Region: 1143-1299
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.74e-36
Family APC10-like 0.0057
Further Details:      
 
Domain Number 3 Region: 366-440
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.02e-30
Family CPH domain 0.0000147
Further Details:      
 
Domain Number 4 Region: 2228-2281
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000698
Family RING finger domain, C3HC4 0.0042
Further Details:      
 
Domain Number 5 Region: 141-198,510-526,723-807,987-1078
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000662
Family RPA1889-like 0.078
Further Details:      
 
Domain Number 6 Region: 2069-2154
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000265
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000031087
Domain Number - Region: 1855-1953
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00254
Family SCF ubiquitin ligase complex WHB domain 0.057
Further Details:      
 
Domain Number - Region: 2141-2209
Classification Level Classification E-value
Superfamily RING/U-box 0.00388
Family IBR domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031087   Gene: ENSPTRG00000018191   Transcript: ENSPTRT00000033638
Sequence length 2517
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:43808541:43852028:1 gene:ENSPTRG00000018191 transcript:ENSPTRT00000033638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGERHAGDLMVPLGPRLQAYPEELIRQRPGHDGHPEYLIRWSVLKCGEVGKVGVEEGKA
EHILMWLSAPEVYANCPGLLGERALSKGLQHEPAGVSGSFPRDPGGLDEVAMGEMEADVQ
ALVRRAARQLAESGTPSLTAAVLHTIHVLSAYASIGPLTGVFRETGALDLLMHMLCNPEP
QIRRSAGKMLQALAAHDAGSRAHVLLSLSQQDGIEQHMDFDSRYTLLELFAETTSSEEHC
MAFEGIHLPQIPGKLLFSLVKRYLCVTSLLDQLNSSPELGAGDQSSPCATREKSRGQREL
EFSMAVGNLISELVRSMGWARNLSEQGMSPPRPTRSIFQPYISGPSLLLPTTVTTPRRQG
WVFRQRSEFSSRSGYGEYVQQTLQPGLRVRMLDDYEEISAGDEGEFRQSNNGIPPVQVFW
QSTGRTYWVHWHMLEILGPEEATEDKASAAVEKGAGATVLGTAFPSWDWNPMDGLYPLPY
LQPEPQKNERVGYLTQAEWWELLFFIKKLDLCEQQPIFQNLWKNLDETLGEKALGEISVS
VEMAESLLQVLSSRFEGSTLNDLLNSQIYTKYGLLSNEQSSSSTSRNHSCTPDPEEESKS
EASFSEEETESLKAKAEAPKTEAEPTKTRTEPPMAQSDSQLFNQLLVTEGMTLPTEMKEA
ASEMARALRGPGPRSSLDQHVAAVVATVQISSLDTHLQLSGLSALSQAVEEVTERDHPLV
RPDRSLREKLVKMLVELLTNQVGEKMVVVQALRLLYLLMTKHEWRPLFAREGGIYAVLVC
MQEYKTSVLVQQAGLAALKMLAVASSSEIPTFVTGRDSIHSLFDAQMTREIFASIDSATR
PGSESLLLTVPAAVILMLNTEGCSSAARNGLLLLNLLLCNHHTLGDQIITRELRDTLFRH
SGIAPGTEPMPTTRTILMMLLNRYSEPPGSPECAALETPIIQGQDGSPELLIRSLVGGPS
AELLLDLERVLCREGSPGGAVRPLLKRLQQETQPFLLLLRTLDAPGPNKTLLLSVLRVIT
RLLDFPEAMVLPWHEVLEPCLNCLSGPSSDSEIVQELTCFLHRLASMHKDYAVVLCCLGA
KEILSKVLDKHSAQLLLGCELRDLVTECEKYAQLYSNLTSSILAGCIQMVLGQIEDHRRT
HQPINIPFFDVFLRHLCQGSSVEVKEDKCWEKVEVSSNPHRASKLTDHNPKTYWESNGST
GSHYITLHMHRGVLVRQLTLLVASEDSSYMPARVVVFGGDSTSCISTELNTVNVMPSASR
VILLENLNRFWPIIQIRIKRCQQGGIDTRVRGVEVLGPKPTFWPLFREQLCRRTCLFYTI
RAQAWSRDIAEDRRRLLQLCPRLNRVLRHEQNFADRFLPDDEAAQALGKTCWEALVSPLV
QNITSPDAEGVSALGWLLDQYLEQRETSRNPLSRAASFASRVRRLCHLLVHVEPPPGPSP
EPSTRPFSKNSKGRDQSPAPSPVLPSSSLRNITQCWLSVVQEQVGRFLAAAWRAPDFVPR
YCKLYEHLQRAGSELFGPRAAFTLALRSGFSGALLQQSFLTAAHMSEQFARYIDQQIQGG
LIGGAPGVDMLGQLQRHLEPIMVLSGLELATTFEHFYQHYMADRLLSFGSSWLEGAVLEQ
IGLCFPNRLPQLMLQSLSTSEELQRQFHLFQLQRLDKLFLEQEDEEEKRLEEEEEEEEEE
EAEKELFIEDPSPAISILVLSPRCWPVSPLCYLYHPRKCLPTEFCDALDRFSSFYSQSQN
HPVLDMGPHRRLQWTWLGRAELQFGNQTLHVSTVQMWLLLKFNQTEEVSVETLLKDSDLS
PELLLQALVPLTSGNGPLTLHEGQDFPHGGVLRLHEPGPQRSGEALWLIPPQAYLNVEKD
EGRTLEQKRNLLSCLLVRILKAHGEKGLHIDQLVCLVLEAWQKGPNPPGTLGHTVAGGVA
CTSTDVLSCILHLLGQGYVKRRDDRPQILMYAAPEPMGPCRGQADVPFCGSQSETSKPSP
EAVATLASLQLPAGRTMSPQEVEGLMKQTVRQVQETLNLEPDVAQHLLAHSHWGAEQLLQ
SYSEDPEPLLLAAGLCVPQAQAVPVRPDHCPVCVSPLGCDDDLPSLCCMHYCCKSCWNEY
LTTRIEQNLVLNCTCPIADCPAQPTGAFIRAIVSSPEVISKYEKALLRGYVESCSNLTWC
TNPQGCDRILCRQGLGCGTTCSKCGWASCFNCSFPEAHYPASCGHMSQWVDDGGYYDGMS
VEAQSKHLAKLISKRCPSCQAPIEKNEGCLHMTCAKCNHGFCWRCLKSWKPNHKDYYNCS
AMVSKAARQEKRFQDYNERCTFHHQAREFAVNLRNRVSAIHEVPPPRSFTFLNDACQGLE
QARKVLAYACVYSFYSQDTEYMDVVEQQTENLELHTNALQILLEETLLRCRDLASSLRLL
RADCLSTGMELLRRIQERLLAILQHSAQDFRVGLQSPSVEAWEAKGPNMPGSQPQASSGP
EAEEEEEDDEDDVPEWQQDEFDEELDNDSFSYDESENLDQETFFFGDEEEDEDEAYD
Download sequence
Identical sequences H2QT22
ENSPTRP00000031087 XP_518908.2.37143 ENSPTRP00000031087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]