SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031266 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031266
Domain Number 1 Region: 31-217
Classification Level Classification E-value
Superfamily vWA-like 3.41e-56
Family Integrin A (or I) domain 0.00017
Further Details:      
 
Domain Number 2 Region: 230-421
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.5e-26
Family Laminin G-like module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031266   Gene: ENSPTRG00000018302   Transcript: ENSPTRT00000033829
Sequence length 957
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:56826604:57018002:-1 gene:ENSPTRG00000018302 transcript:ENSPTRT00000033829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHYITFLCMVLVLLLQNSVLAEDGEVRSSCRTAPTDLVFILDGSYSVGPENFEIVKKWL
VNITKNFDIGPKFIQVGVVQYSDYPVLEIPLGSYDSGEHLTAAVESILYLGGNTKTGKAI
QFALDYLFAKSSRFLTKIAVVLTDGKSQDDVKDAAQAARDSKITLFAIGVGSETEDAELR
AIANKPSSTYVFYVEDYIAISKIREVMKQKLCEESVCPTRIPVAARDERGFDILLGLDVN
KKVKKRIQLSPKKIKGYEVTSKVDLSELTSNVFPEGLPPSYVFVSTQRFKVKKIWDLWRI
LTIDGRPQIAVTLNGVDKILLFTTTSVINGSQVVTFANPQVKTLFDEGWHQIRLLVTEQD
VTLYIDDQQIENKPLHPVLGILINGQTQIGKYSGKEETVQFDVQKLRIYCDPEQNNRETA
CEIPGFVSKCLNGPSDVGSTPAPCICPPGKPGLQGPKGDPGLPGNPGYPGQPGQDGKPGY
QGIAGTPGVPGSPGIQGARGLPGYKGEPGRDGDKGDRGLPGFPGLHGMPGSKGEMGAKGD
KGSPGFYGKKGAKGEKGNAGFPGLPGPAGEPGRHGKDGLMGSPGFKGEAGSPGAPGQDGT
RGEPGIPGFPGNRGLMGQKGEIGPPGQQGKKGAPGMPGLMGSNGSPGQPGTPGSKGSKGE
PGIQGMPGASGLKGEPGAMGSPGEPGYMGLPGIQGKKGDKGNQGEKGIQGQKGENGRQGI
PGQQGIQGHHGTKGERGEKGEPGVRGAIGSKGESGVDGLMGPAGPKGQPGDPGPQGPPGL
DGKPGREFSEQFIRQVCTDVIRAQLPVLLQSGRIRNCDHCLSQHGSPGIPGPPGPIGPEG
PRGLPGLPGRDGVPGLVGVPGRPGVRGLKGLPGRNGEKGSQGFGHPGEQGPPGPPGPEGP
PGISKEGPPGDPGLPGKDGDHGKPGIQGQPGPPGICDPSLCFSVIARRDPFRKGPNY
Download sequence
Identical sequences ENSPTRP00000031266 ENSPTRP00000031266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]