SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031283 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000031283
Domain Number - Region: 21-84
Classification Level Classification E-value
Superfamily STAT 0.0745
Family STAT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031283   Gene: ENSPTRG00000018307   Transcript: ENSPTRT00000033848
Sequence length 211
Comment pep:known chromosome:CHIMP2.1.4:6:57921693:57934586:1 gene:ENSPTRG00000018307 transcript:ENSPTRT00000033848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAKINAKANEGRFCRSSSMADRSSRLLESLDQLELRVEALREAATAVEQEKEILLEMI
HSIQNSQDMRQISDGEREELNLTANRLMGRTLTVEVSVETIRNPQQQESLKHATRIIDEV
VNKFLDDLGNAKSHLMSLYSACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRN
IENSDKAIKLLEHSKGAGSKTLQQNAESRFN
Download sequence
Identical sequences G3RUC1 H2QT89 O95816
gi|4757834|ref|NP_004273.1| 9598.ENSPTRP00000031283 9606.ENSP00000359727 NP_004273.1.87134 NP_004273.1.92137 XP_001158523.1.37143 XP_003828970.1.60992 XP_004044284.1.27298 XP_018884952.1.27298 ENSP00000359727 ENSGGOP00000019399 HR4405 ENSGGOP00000019399 ENSPTRP00000031283 ENSPTRP00000031283 ENSP00000359727 ENSP00000359727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]