SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031314 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031314
Domain Number 1 Region: 71-243
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-32
Family Laminin G-like module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031314   Gene: ENSPTRG00000018327   Transcript: ENSPTRT00000033880
Sequence length 1142
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:70155423:70505813:1 gene:ENSPTRG00000018327 transcript:ENSPTRT00000033880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTGPWKLWLWMSIFLLPASTSVTVRDKTEESCPILRIEGHQLTYDNINKLEVSGFDLG
DSFSLRRAFCESDKTCFKLGSALLIRDTIKIFPKGLPEEYSVAAMFRVRRNAKKERWFLW
QVLNQQNIPQISIVVDGGKKVVEFMFQATEGDVLNYIFRNRELRPLFDRQWHKLGISIQS
QVISLYMDCNLIARRQTDEKDTVDFHGRTVIATRASDGKPVDIELHQLKIYCSANLIAQE
TCCEISDTKCPEQDGFGNIASSSVTAHASKMSSYLPAKQELKDQCQCIPNKGEAGLPGAP
GSPGQKGHKGEPGENGLHGAPGFPGQKGEQGFEGSKGETGEKGEQGEKGDPGLAGLNGEN
GLKGDLGPHGPPGPKGEKGDTGPPGPPALPGSLGIQGPQGPPGKEGQRGRRGKTGPPGKP
GPPGPPGPPGIQGIHQTLGGYYNKDNKGNDEHEAGGLKGDKGETGLPGFPGSVGPKGQKG
EPGEPFTKGEKGDRGEPGIIGSQGVKGEPGDPGPPGLIGSPGLKGQQGSAGSTGPRGPPG
DVGLPGEHGIPGKQGIKGEKGDPGGIIGPPGLPGPKGEAGPPGKSLPGEPGLDGNPGAPG
PRGPKGERGLPGVHGSPGDIGPPGIGIPGRTGAQGPAGEPGIQGPRGLPGLPGTPGTPGN
DGVPGRDGKPGLPGPPGDPIALPLLGDIGALLKNFCGNCQASVPGLKSNKGEEGGAGEPG
KYDSMARKGDIGPQGPPGIPGREGPKGSKGERGYPGIPGEKGDEGLQGIPGIPGAPGPTG
PPGLMGRTGHPGPTGAKGEKGSDGPPGKPGPPGPPGIPFNEGNGMSSLYKIKGGVNVPSY
PGPPGPPGPKGDPGPVGEPGAMGLPGLEGFPGVKGDRGPAGPPGIAGMSGKPGAPGPPGV
PGEPGERGPVGDIGFPGPEGPSGKPGINGKDGIPGAQGIMGKPGDRGPKGERGDQGIPGD
RGSQGERGKPGLTGMKGAIGPMGPPGNKGSMGSPGHQGPPGSPGIPGIPADAVSFEEIKK
YINQEVLRIFEERMAVFLSQLKLPAAMLAAQAYGRPGPPGKDGLPGPPGDPGPQGYRGQK
GERGEPGIGLPGSPGLPGTSALGLPGSPGAPGPQGPPGPSGRCNPEDCLYPVSHAHQRTG
GN
Download sequence
Identical sequences H2QT96
XP_001135236.1.37143 XP_016811253.1.37143 XP_016811254.1.37143 9598.ENSPTRP00000031314 ENSPTRP00000031314 ENSPTRP00000031314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]